Host taxon 9606
Protein NP_001186904.1
cytochrome b-c1 complex subunit 7 isoform 2
Homo sapiens
Gene UQCRB, UniProt P14927
>NP_001186904.1|Haemophilus ducreyi 35000HP|cytochrome b-c1 complex subunit 7 isoform 2
MRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.8 | 0.797220132587826 | 0.00088 | 31213562 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)