Host taxon 9606
Protein NP_054890.1
cysteine-rich PDZ-binding protein
Homo sapiens
Gene CRIPT, UniProt Q9P021
>NP_054890.1|Haemophilus ducreyi 35000HP|cysteine-rich PDZ-binding protein
MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.63 | -0.627154099896374 | 0.0094 | 31213562 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)