Host taxon 9606
Protein NP_115788.1
cysteine-rich and transmembrane domain-containing protein 1
Homo sapiens
Gene CYSTM1, UniProt Q9H1C7
>NP_115788.1|Haemophilus ducreyi 35000HP|cysteine-rich and transmembrane domain-containing protein 1
MNQENPPPYPGPGPTAPYPPYPPQPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDELGPSTCLTACWTALCCCCLWDMLT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.32 | 1.32356964140415 | 9.3e-5 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)