Host taxon 9606
Protein NP_005204.1
cystatin-A
Homo sapiens
Gene CSTA, UniProt P01040
>NP_005204.1|Haemophilus ducreyi 35000HP|cystatin-A
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.22 | 2.21745858740322 | 6.2e-7 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)