Host taxon 9606
Protein NP_001791.1
cyclin-dependent kinase 4 inhibitor D
Homo sapiens
Gene CDKN2D, UniProt P55273
>NP_001791.1|Haemophilus ducreyi 35000HP|cyclin-dependent kinase 4 inhibitor D
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.81 | 1.81188821953786 | 4.3e-13 | 31213562 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)