Host taxon 9606
Protein NP_004927.2
cyclin-dependent kinase 4 inhibitor B isoform 1
Homo sapiens
Gene CDKN2B, UniProt P42772
>NP_004927.2|Haemophilus ducreyi 35000HP|cyclin-dependent kinase 4 inhibitor B isoform 1
MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.56 | -0.555102012464001 | 0.028 | 31213562 | |
Retrieved 1 of 2 entries in 0.5 ms
(Link to these results)