Host taxon 9606
Protein NP_064573.1
COX assembly mitochondrial protein 2 homolog isoform 1
Homo sapiens
Gene CMC2, UniProt Q9NRP2
>NP_064573.1|Haemophilus ducreyi 35000HP|COX assembly mitochondrial protein 2 homolog isoform 1
MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESEK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.76 | 0.758640902896881 | 0.00027 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)