Host taxon 9606
Protein NP_067066.1
costars family protein ABRACL
Homo sapiens
Gene ABRACL, UniProt Q9P1F3
>NP_067066.1|Haemophilus ducreyi 35000HP|costars family protein ABRACL
MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGVHDDVDIILLQD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.53 | 1.52812518003902 | 0.00011 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)