Host taxon 9606
Protein NP_001186757.1
cornifin-A
Homo sapiens
Gene SPRR1A, UniProt P35321
>NP_001186757.1|Haemophilus ducreyi 35000HP|cornifin-A
MNSQQQKQPCTPPPQPQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCQPKVPEPCPSTVTPAPAQQKTKQK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.29 | 2.28867668484695 | 0.00041 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)