Host taxon 9606
Protein NP_001156896.1
COP9 signalosome complex subunit 9 isoform 2
Homo sapiens
Gene COPS9, UniProt Q8WXC6
>NP_001156896.1|Haemophilus ducreyi 35000HP|COP9 signalosome complex subunit 9 isoform 2
MKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDIQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.43 | 1.43213483682 | 1.2e-6 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)