Host taxon 9606
Protein NP_060875.2
coordinator of PRMT5 and differentiation stimulator isoform 1
Homo sapiens
Gene COPRS, UniProt Q9NQ92
>NP_060875.2|Haemophilus ducreyi 35000HP|coordinator of PRMT5 and differentiation stimulator isoform 1
MDLQAAGAQAQGAAEPSRGPPLPSARGAPPSPEAGFATADHSSQERETEKAMDRLARGTQSIPNDSPARGEGTHSEEEGFAMDEEDSDGELNTWELSEGTNCPPKEQPGDLFNEDWDSELKADQGNPYDADDIQESISQELKPWVCCAPQGDMIYDPSWHHPPPLIPYYSKMVFETGQFDDAED
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.7 | 0.701955915533403 | 0.00074 | 31213562 | |
Retrieved 1 of 2 entries in 2 ms
(Link to these results)