Host taxon 9606
Protein NP_001273310.1
constitutive coactivator of peroxisome proliferator-activated receptor gamma isoform d
Homo sapiens
Gene FAM120B, UniProt Q96EK7
>NP_001273310.1|Haemophilus ducreyi 35000HP|constitutive coactivator of peroxisome proliferator-activated receptor gamma isoform d
MTIPGGTPSLKILWLNQEPEIQVRRLDTLLACFNLSSSREELQAVESPFQALCCLLIYLFVQVDTLCLEDLHAFIAQALCLQGKSTSQLVNLQPDYINPRAVQLGSLLVRGLTTLVLVNSACGFPWKTSDFMPWNVFDGKLFHQKYLQSEKGYAVEVLLEQNRSRLTKFHNLKAVVCKACMKENRRITGRAHWGSHHAGRWGRQGSSYHRTGSGYSRSSQGQPWRDQGPGSRQYEHDQWRRY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.72 | -1.71953200707091 | 0.018 | 31213562 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)