Host taxon 9606
Protein NP_859056.2
complex III assembly factor LYRM7 isoform 1
Homo sapiens
Gene LYRM7, UniProt Q5U5X0
>NP_859056.2|Haemophilus ducreyi 35000HP|complex III assembly factor LYRM7 isoform 1
MGRAVKVLQLFKTLHRTRQQVFKNDARALEAARIKINEEFKNNKSETSSKKIEELMKIGSDVELLLRTSVIQGIHTDHNTLKLVPRKDLLVENVPYCDAPTQKQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.65 | -0.645949736738698 | 1.2e-6 | 31213562 | |
Retrieved 1 of 2 entries in 0.6 ms
(Link to these results)