Host taxon 9606
Protein NP_001203.1
complement component 1 Q subcomponent-binding protein, mitochondrial precursor
Homo sapiens
Gene C1QBP, UniProt Q07021
>NP_001203.1|Haemophilus ducreyi 35000HP|complement component 1 Q subcomponent-binding protein, mitochondrial precursor
MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.01 | 1.01250846974565 | 0.0002 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)