Host taxon 9606
Protein NP_001129577.1
colorectal cancer-associated protein 2 isoform 2
Homo sapiens
Gene COLCA2, UniProt A8K830
>NP_001129577.1|Haemophilus ducreyi 35000HP|colorectal cancer-associated protein 2 isoform 2
MHPEPLLNSTQSAPHHFPDSFQATPFCFNQSLIPGSPSNSSILSGSLDYSYSPVQLPSYAPENYNSPASLDTRTCGYPPEDHSYQHLSSHAQYSCFSSATTSICYCASCEAEDLDALQAAEYFYPSTDCVDFAPSAAATSDFYKRETNCDICYS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.84 | -0.840289902247129 | 0.028 | 31213562 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)