Host taxon 9606
Protein NP_055275.1
cold shock domain-containing protein C2
Homo sapiens
Gene CSDC2, UniProt Q9Y534
>NP_055275.1|Haemophilus ducreyi 35000HP|cold shock domain-containing protein C2
MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQKFQAVEVVLTQLAPHTPHETWSGQVVGS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ -1.38 | -1.37657132603186 | 3.6e-7 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)