Host taxon 9606
Protein NP_001011667.1
coiled-coil-helix-coiled-coil-helix domain-containing protein 7 isoform a
Homo sapiens
Gene CHCHD7, UniProt Q9BUK0
>NP_001011667.1|Haemophilus ducreyi 35000HP|coiled-coil-helix-coiled-coil-helix domain-containing protein 7 isoform a
MKCEETHAPNSNWVYVMLPSKKTVRMPSVTQRLRDPDINPCLSILFYLLNDASLISVRNLMLPPDVWMKITMTGKGVPLTS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.76 | 0.761717863537316 | 0.0011 | 31213562 | |
Retrieved 1 of 2 entries in 1.8 ms
(Link to these results)