Host taxon 9606
Protein NP_057223.1
coiled-coil-helix-coiled-coil-helix domain-containing protein 2 precursor isoform 2
Homo sapiens
Gene CHCHD2, UniProt Q9Y6H1
>NP_057223.1|Haemophilus ducreyi 35000HP|coiled-coil-helix-coiled-coil-helix domain-containing protein 2 precursor isoform 2
MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.07 | 1.06584397466711 | 0.00037 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)