Host taxon 9606
Protein NP_006839.2
coiled-coil domain-containing protein 85B
Homo sapiens
Gene CCDC85B, UniProt Q15834
>NP_006839.2|Haemophilus ducreyi 35000HP|coiled-coil domain-containing protein 85B
MEAEAGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVREDLGGCWQKLAELEGRQEELLRENLALKELCLALGEEWGPRGGPSGAGGSGAGPAPELALPPCGPRDLGDGSSSTGSVGSPDQLPLACSPDD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.69 | 0.692814902357192 | 2.9e-5 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)