Host taxon 9606
Protein NP_001307747.1
coenzyme Q-binding protein COQ10 homolog B, mitochondrial isoform 2
Homo sapiens
Gene COQ10B, UniProt Q9H8M1
>NP_001307747.1|Haemophilus ducreyi 35000HP|coenzyme Q-binding protein COQ10 homolog B, mitochondrial isoform 2
MAARTGHTALRRVVSGCRPKSATAAGAQAPVRNGRYSMQEMYDVVSGVEDYKHFVPWCKKSDVISKRSGYCKTRLEIGFPPVLERYTSVVTLVKPHLVKASCTDGRLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACKLYGPETNIPRELMLHEVHHT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.59 | 0.590311024180924 | 0.0061 | 31213562 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)