Host taxon 9606
Protein NP_001191406.1
CMT1A duplicated region transcript 4 protein
Homo sapiens
Gene CDRT4, UniProt Q8N9R6
>NP_001191406.1|Haemophilus ducreyi 35000HP|CMT1A duplicated region transcript 4 protein
MDARRMKKEEGLTENTGLPRKLLEKHDPWPAYVTYTSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSSGKAVFRDTLSESTLSMWGAYSVLAMAPTMIPEPTHLHADSRDCPTENYNKIIFARKPMMRMLPTVRY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.86 | -0.855321503203013 | 0.00031 | 31213562 | |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)