Host taxon 9606
Protein NP_777552.3
CMRF35-like molecule 7 precursor
Homo sapiens
Gene CD300LB, UniProt A8K4G0
>NP_777552.3|Haemophilus ducreyi 35000HP|CMRF35-like molecule 7 precursor
MWLPPALLLLSLSGCFSIQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHYMLLVFVKVPILLILVTAILWLKGSQRVPEEPGEQPIYMNFSEPLTKDMAT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.99 | 1.98580881701774 | 0.00021 | 31213562 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)