Host taxon 9606
Protein NP_001028677.1
cleavage stimulation factor subunit 3 isoform 2
Homo sapiens
Gene CSTF3, UniProt Q12996
>NP_001028677.1|Haemophilus ducreyi 35000HP|cleavage stimulation factor subunit 3 isoform 2
MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.51 | 0.508494729701854 | 0.00098 | 31213562 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)