Host taxon 9606
Protein NP_001307237.1
CKLF-like MARVEL transmembrane domain-containing protein 8 isoform 2
Homo sapiens
Gene CMTM8, UniProt Q8IZV2
>NP_001307237.1|Haemophilus ducreyi 35000HP|CKLF-like MARVEL transmembrane domain-containing protein 8 isoform 2
MEEPQRARSHTVTTTASSFAENFSTSSSSFAYDREFLRTLPGFLIVAEIGLCFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGNTYFSFIAWRSRTIQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.67 | -0.672491982674521 | 0.042 | 31213562 | |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)