Host taxon 9606
Protein NP_612419.1
CKLF-like MARVEL transmembrane domain-containing protein 7 isoform a
Homo sapiens
Gene CMTM7, UniProt Q96FZ5
>NP_612419.1|Haemophilus ducreyi 35000HP|CKLF-like MARVEL transmembrane domain-containing protein 7 isoform a
MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGLVAGAIFGFMATFLCMASIWLSYKISCVTQSTDAAV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.71 | 1.71174241703888 | 2.9e-8 | 31213562 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)