Host taxon 9606
Protein NP_037374.1
cilia- and flagella-associated protein 20
Homo sapiens
Gene CFAP20, UniProt Q9Y6A4
>NP_037374.1|Haemophilus ducreyi 35000HP|cilia- and flagella-associated protein 20
MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.6 | 0.603668900954972 | 0.0073 | 31213562 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)