Host taxon 9606
Protein NP_001120700.1
chromobox protein homolog 1
Homo sapiens
Gene CBX1, UniProt P83916
>NP_001120700.1|Haemophilus ducreyi 35000HP|chromobox protein homolog 1
MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.53 | 0.531107422505444 | 0.025 | 31213562 | |
Retrieved 1 of 2 entries in 2.1 ms
(Link to these results)