Host taxon 9606
Protein NP_001035228.1
chemokine-like factor isoform e
Homo sapiens
Gene CKLF, UniProt Q9UBR5
>NP_001035228.1|Haemophilus ducreyi 35000HP|chemokine-like factor isoform e
MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITGFEVTVILFFILLYVLRLDRLMKWLFWPLLDIINSLVTTVFMLIVSVLALIPETTTLTVGGGLF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.27 | 1.26818146316148 | 0.00088 | 31213562 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)