Host taxon 9606
Protein NP_116287.3
centrosomal protein of 19 kDa isoform 1
Homo sapiens
Gene CEP19, UniProt Q96LK0
>NP_116287.3|Haemophilus ducreyi 35000HP|centrosomal protein of 19 kDa isoform 1
MMCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFSFLRGYLSGQSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDDPNFVYDIEVEFPQDDQLQSCGWDTESADEF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.71 | 1.70841122927457 | 5.7e-5 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)