Host taxon 9606
Protein NP_001034891.1
cell division control protein 42 homolog isoform 1 precursor
Homo sapiens
Gene CDC42, UniProt P60953
>NP_001034891.1|Haemophilus ducreyi 35000HP|cell division control protein 42 homolog isoform 1 precursor
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.67 | 0.666818865270789 | 0.00033 | 31213562 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)