Host taxon 9606
Protein NP_001230678.1
cell cycle regulator of non-homologous end joining isoform 2
Homo sapiens
Gene CYREN, UniProt Q9BWK5
>NP_001230678.1|Haemophilus ducreyi 35000HP|cell cycle regulator of non-homologous end joining isoform 2
METLQSETKTRVLPSWLTAQVATKNVAPMKAPKRMRMAAVPVAAARCDSSGQKTPANLTPCDKDCVLHE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.99 | 0.985727762560213 | 7.1e-6 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)