Host taxon 9606
Protein NP_115686.3
caspase recruitment domain-containing protein 19 isoform 1
Homo sapiens
Gene CARD19, UniProt Q96LW7
>NP_115686.3|Haemophilus ducreyi 35000HP|caspase recruitment domain-containing protein 19 isoform 1
MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALQNSDCTELDSGSQSGELSNRGPMSFLAGLGLAVGLALLLYCYPPDPKGLPGTRRVLGFSPVIIDRHVSRYLLAFLADDLGGL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.26 | 1.25720345989148 | 1.2e-7 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)