Host taxon 9606
Protein NP_001159684.1
cardiotrophin-like cytokine factor 1 isoform 2 precursor
Homo sapiens
Gene CLCF1, UniProt Q9UBD9
>NP_001159684.1|Haemophilus ducreyi 35000HP|cardiotrophin-like cytokine factor 1 isoform 2 precursor
MLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.91 | 0.913290870358804 | 0.0052 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)