Host taxon 9606
Protein NP_001264092.1
carcinoembryonic antigen-related cell adhesion molecule 3 isoform 2 precursor
Homo sapiens
Gene CEACAM3, UniProt P40198
>NP_001264092.1|Haemophilus ducreyi 35000HP|carcinoembryonic antigen-related cell adhesion molecule 3 isoform 2 precursor
MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGIVTGVLVGVALVAALVCFLLLAKTGRPWSLPQLCLLDVPSLHCPGPPTQPQDSSFHL
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 5.58 | 5.58055648916482 | 8.5e-19 | 31213562 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)