Host taxon 9606
Protein NP_001243245.1
carbohydrate sulfotransferase 9 isoform 2
Homo sapiens
Gene CHST9, UniProt Q7L1S5
>NP_001243245.1|Haemophilus ducreyi 35000HP|carbohydrate sulfotransferase 9 isoform 2
MQPSEMVMNPKQVFLSVLIFGVAGLLLFMYLQVWIEEQHTGRVEKRREQKVTSGWGPVKYLRPVPRIKPQVSHA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ -2.24 | -2.23523404477137 | 5.0e-5 | 31213562 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)