Host taxon 9606
Protein NP_001794.2
CAMPATH-1 antigen precursor
Homo sapiens
Gene CD52, UniProt P31358
>NP_001794.2|Haemophilus ducreyi 35000HP|CAMPATH-1 antigen precursor
MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.55 | 2.55293872779542 | 1.8e-7 | 31213562 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)