Host taxon 9606
Protein NP_071380.1
calcineurin B homologous protein 2
Homo sapiens
Gene CHP2, UniProt O43745
>NP_071380.1|Haemophilus ducreyi 35000HP|calcineurin B homologous protein 2
MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVNPLGDRIIESFFPDGSQRVDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAFQLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKSLEKMDVEQKMSIRILK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●○ -3.99 | -3.99486363071108 | 5.7e-6 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)