Host taxon 9606
Protein NP_002407.1
C-X-C motif chemokine 9 precursor
Homo sapiens
Gene CXCL9, UniProt Q07325
>NP_002407.1|Haemophilus ducreyi 35000HP|C-X-C motif chemokine 9 precursor
MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 6.59 | 6.59265349158384 | 1.1e-9 | 31213562 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)