Host taxon 9606
Protein NP_002984.1
C-X-C motif chemokine 6 precursor
Homo sapiens
Gene CXCL6, UniProt P80162
>NP_002984.1|Haemophilus ducreyi 35000HP|C-X-C motif chemokine 6 precursor
MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 10.14 | 10.1383736259643 | 3.3e-8 | 31213562 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)