Host taxon 9606
Protein NP_002081.2
C-X-C motif chemokine 3 precursor
Homo sapiens
Gene CXCL3, UniProt P19876
>NP_002081.2|Haemophilus ducreyi 35000HP|C-X-C motif chemokine 3 precursor
MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 5.94 | 5.9431023113396 | 2.2e-14 | 31213562 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)