Host taxon 9606
Protein NP_006410.1
C-X-C motif chemokine 13 precursor
Homo sapiens
Gene CXCL13, UniProt O43927
>NP_006410.1|Haemophilus ducreyi 35000HP|C-X-C motif chemokine 13 precursor
MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 6,44 | 6.44409651856044 | 2,3e-5 | 31213562 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)