Host taxon 9606
Protein NP_037384.1
C-type lectin domain family 5 member A isoform 1
Homo sapiens
Gene CLEC5A, UniProt Q9NY25
>NP_037384.1|Haemophilus ducreyi 35000HP|C-type lectin domain family 5 member A isoform 1
MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ 2.6 | 2.60092216940315 | 1.7e-5 | 31213562 | |
Retrieved 1 of 2 entries in 0.4 ms
(Link to these results)