Host taxon 9606
Protein NP_525126.2
C-type lectin domain family 4 member D
Homo sapiens
Gene CLEC4D, UniProt Q8WXI8
>NP_525126.2|Haemophilus ducreyi 35000HP|C-type lectin domain family 4 member D
MGLEKPQSKLEGGMHPQLIPSVIAVVFILLLSVCFIASCLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 7,29 | 7.29068826827944 | 1,8e-32 | 31213562 | |
Retrieved 1 of 1 entries in 0,9 ms
(Link to these results)