Host taxon 9606
Protein NP_001124183.1
C-type lectin domain family 2 member A isoform 1
Homo sapiens
Gene CLEC2A, UniProt Q6UVW9
>NP_001124183.1|Haemophilus ducreyi 35000HP|C-type lectin domain family 2 member A isoform 1
MINPELRDGRADGFIHRIVPKLIQNWKIGLMCFLSIIITTVCIIMIATWSKHAKPVACSGDWLGVRDKCFYFSDDTRNWTASKIFCSLQKAELAQIDTQEDMEFLKRYAGTDMHWIGLSRKQGDSWKWTNGTTFNGWFEIIGNGSFAFLSADGVHSSRGFIDIKWICSKPKYFL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●○○ -2.97 | -2.97000527297122 | 3.4e-5 | 31213562 | |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)