Host taxon 9606
Protein NP_001288802.1
C-C motif chemokine 28 isoform a precursor
Homo sapiens
Gene CCL28, UniProt Q9NRJ3
>NP_001288802.1|Haemophilus ducreyi 35000HP|C-C motif chemokine 28 isoform a precursor
MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.77 | -0.769992582102473 | 0.0022 | 31213562 | |
Retrieved 1 of 3 entries in 2.2 ms
(Link to these results)