Host taxon 9606
Protein NP_002980.1
C-C motif chemokine 21 precursor
Homo sapiens
Gene CCL21, UniProt O00585
>NP_002980.1|Haemophilus ducreyi 35000HP|C-C motif chemokine 21 precursor
MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●○○○ 1.62 | 1.62421589529483 | 8.8e-5 | 31213562 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)