Host taxon 9606
Protein NP_001123518.1
C-C motif chemokine 20 isoform 2 precursor
Homo sapiens
Gene CCL20, UniProt P78556
>NP_001123518.1|Haemophilus ducreyi 35000HP|C-C motif chemokine 20 isoform 2 precursor
MCCTKSLLLAALMSVLLLHLCGESEASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●●●●● 4.41 | 4.40796514036624 | 5.1e-7 | 31213562 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)