Host taxon 9606
Protein NP_001123466.1
BTB/POZ domain-containing protein KCTD15 isoform 2
Homo sapiens
Gene KCTD15, UniProt Q96SI1
>NP_001123466.1|Haemophilus ducreyi 35000HP|BTB/POZ domain-containing protein KCTD15 isoform 2
MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQVLERLFQRGFSVAASCGGGVDSSQFSEYVLCREERRPQPTPTAVRIKQEPLD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ -0.82 | -0.816150652027742 | 0.00068 | 31213562 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)