Host taxon 9606
Protein NP_001139255.1
BLOC-1-related complex subunit 8 isoform 2
Homo sapiens
Gene BORCS8, UniProt Q96FH0
>NP_001139255.1|Haemophilus ducreyi 35000HP|BLOC-1-related complex subunit 8 isoform 2
MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYACSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQGHR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.53 | 0.525684918421177 | 0.017 | 31213562 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)