Host taxon 9606
Protein NP_036520.1
biogenesis of lysosome-related organelles complex 1 subunit 6 isoform 2
Homo sapiens
Gene BLOC1S6, UniProt Q9UL45
>NP_036520.1|Haemophilus ducreyi 35000HP|biogenesis of lysosome-related organelles complex 1 subunit 6 isoform 2
MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Haemophilus ducreyi 35000HP | 233412 | infected host | Skin tissue | 6-8 days | ●○○○○ 0.84 | 0.839727990801482 | 6.3e-7 | 31213562 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)